Certified 1.9 Carat Moissanite Flower Stud Earrings

Sale price $1,737.00 Regular price $1,997.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Capture the beauty of floral design with these stunning Flower Stud Earrings that bring a graceful sparkle to your jewelry collection. At the center of the charming Flower motif sits a brilliant 6 mm Round Shape Moissanite stone that shines beautifully with every movement. Surrounding the center are tiny Moissanite stones studded over the flower motif that feels elegant, feminine and timeless. The combination of the bright center stone and the dainty surrounding stones adds depth and sparkle, making these Moissanite Earrings eye-catching. Designed to be both stylish and comfortable, these Moissanite Studs are easy to wear throughout the day. Perfect for weddings, celebrations or even everyday elegance, these Moissanite Stud Earrings add a touch of charm to any look. They come beautifully packed in a jewelry box, making them a thoughtful gift for birthdays, anniversaries or a sweet surprise for someone special. Elegant and beautifully crafted, these Moissanite Diamond Earrings are made to brighten every moment.

Product Information
SKU SHP-EARRINGS062196990
Length 8.8 mm
Width 8.4 mm
Height 5.5 mm
Metal Weight 2.80 gm (Approximate)
Total Stone Weight 2.34 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 86 Pieces
Total Weight 2.34 Carat (Approximate)
Dimension(approx) Round-6X6 mm-2 Pcs
Round-1.10X1.10 mm-12 Pcs
Round-1X1 mm-48 Pcs
Round-0.80X0.80 mm-24 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type 6 Claw Prong Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-earrings