Certified 0.9 Carat Lab Grown Diamond Floral Engagement Ring

Sale price $2,209.00 Regular price $2,539.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bring a touch of natures brilliance to your jewelry collection with this Diamond Flower Ring. We designed this Nature Inspired Engagement Ring for those who love minimal things with a touch of uniqueness, it features a 0.9 Carat round cut lab grown diamond set in a safe prong setting and takes the spotlight. Encircling it is a diamond halo carefully arranged in a scalloped motif, adding a perfect amount of sparkle with floral design. The bypass shank with a diamond studded leaf gives it a graceful and modern touch. This Lab Created Diamond Engagement Ring comes with a certificate of guarantee for quality assurance and comes packaged in a chic, protective box, ideal for gifting or safe storage when not in use. Present her with a flower that will remain for eternity through this stunning Floral Engagement Ring. Featuring nature-influenced designs, this piece embodies the spirit of love and is a must-have for every jewelry collector. Make this Bypass Engagement Ring yours today and let her discover the happiness it brings. The shine of EF-VS Lab Grown Diamonds is made with great precision and is perfect for those who appreciate the beauty of elaborate designs.

Product Information
SKU SHP-RINGS052410107
Metal Weight 3.50 gm (Approximate)
Center Stone Weight 0.99 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 19 Pieces
Total Weight 1.13 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Round-1.20X1.20 mm-18 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More