Certified 0.8 Carat Lab Grown Black Diamond Flower Engagement Ring with White Diamond

Regular price $2,460.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

For the ones who believe love should blossom endlessly, this Flower Engagement Ring brings a poetic touch to forever. At its center sits a 5 mm Synthetic Black Diamond, placed within a Rose Flower Motif that represents growth, beauty and the strength of a love that continues to bloom with time. The flower design symbolizes new beginnings and the natural unfolding of two lives coming together in perfect harmony. Surrounding the center, the Bypass Band flows gracefully like two paths gently crossing, accented with dainty Round Shape White Diamond stones that add a soft, sparkling brilliance reminiscent of morning dew on petals. The contrast of deep black and radiant white creates a striking balance, reflecting passion paired with purity and individuality blended with unity. This Black and White Diamond Engagement Ring is a celebration of a relationship that evolves, flourishes and stays rooted in devotion. Perfect as an engagement ring or a heartfelt promise, this Lab Grown Black Diamond Engagement Ring carries the meaning of love that grows stronger with every shared moment. Delivered in a signature jewelry box and available in various ring sizes, it offers both elegance and comfort.

Product Information
SKU SHP-RINGS0821192907
Width 5 mm
Height 11.5 mm
Metal Weight 3.22 gm (Approximate)
Center Stone Weight 0.84 Carat (Approximate)
SYNTHETIC BLACK DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.84 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA ( Synthetic )
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-14 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
flower-jewelry