Brilliant Cut Lab Created Ruby Floral Engagement Ring with Certificate

Regular price $1,963.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Design with Brilliant Ruby Center

This brilliant cut lab created ruby floral engagement ring is designed for those who want a proposal ring with vibrant color and symbolic detail. The center ruby draws attention with its rich tone and precise faceting, while the surrounding floral-inspired design adds softness and dimension. It is an expressive choice for someone seeking a ring that feels both romantic and distinctive.

Floral Setting with Structured Support

The floral motif is crafted to frame the center stone in a balanced composition. The setting supports the ruby securely while allowing light to interact with its brilliant cut. The overall silhouette remains refined on the finger, blending decorative detail with everyday elegance.

Lab Created Ruby with Certification

The center stone is a lab created ruby, formed without traditional mining. Lab created gemstones offer controlled quality and consistent color, though impact varies by production and energy source. Certification details and gemstone specifications are outlined in the product information tables for full transparency.

High-Level Features

  • Brilliant cut lab created ruby center stone.
  • Floral-inspired engagement ring design.
  • Comes with certification as specified.
  • Designed as a single engagement ring.
Product Information
SKU SHP-RINGS102023531
Width 4.3 mm
Height 6.8 mm
Metal Weight 2.65 gm (Approximate)
Center Stone Weight 1.37 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 1.37 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
MOISSANITE INFORMATION
No.of Stones 8 Pieces
Total Weight 0.58 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-8 Pcs
Color White
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
lab-created-ruby-engagement-rings