Brilliant Cut Diamond Flower Promise Ring

Regular price $1,787.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

The Diamond Flower Promise Ring is designed for a love that feels soft, sincere, and ready to grow. A cluster of round diamonds forms the heart of its twin floral design, while polished metal petals add a romantic nature-inspired shape around the sparkle. With its delicate flower profile and promise-ring meaning, this design is a thoughtful choice for commitment, proposal moments, anniversary gifting, or a personal milestone that deserves a symbol with feeling.

Brilliant Cut Round Diamonds Diamond Flower Promise Ring For Her

Crafted with 14 round diamonds in a brilliant cut, this flower promise ring brings a graceful sparkle to a compact floral silhouette. The diamonds are arranged in an illusion setting, creating a fuller look while keeping the design refined and wearable. With an approximate total diamond weight of 0.06 carat, HI color, SI quality grade, and metal choices including 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, the ring offers a meaningful blend of sentiment, shine, and personalization.

What Makes This Special

  • Flower-inspired promise ring with a twin floral design.
  • Set with 14 round brilliant cut diamonds.
  • Approximate total diamond weight of 0.06 carat.
  • Illusion setting creates a graceful, clustered diamond look.
  • Diamond quality details include HI color and SI grade.
  • Approximate dimensions include 10 mm width and 2 mm height.
  • Available in 92.5 sterling silver, 10K gold, 14K gold, and 18K gold options in white or yellow gold finishes.

Why Choose This Design

The floral form gives this ring a softer, more personal feel than a classic promise ring. Its round brilliant cut diamonds are chosen for lively light return, while the illusion setting helps the small diamond cluster appear more visually expressive. The low 2 mm height supports comfortable wear, and the 10 mm width gives the flower motif enough presence to feel meaningful without becoming overpowering. For buyers who want a promise ring with symbolism, sparkle, and everyday ease, this design offers a romantic alternative to a traditional band.

Design Meaning

A flower design naturally speaks of growth, renewal, and affection that continues to bloom. In this ring, the twin floral arrangement gives the piece a deeper emotional connection, making it fitting for a promise shared between two people, a relationship milestone, or a fresh beginning. The diamonds at the center of the flower add a bright, lasting expression of commitment, while the petal-inspired metalwork gives the ring a gentle nature-led character.

Authenticity & Craftsmanship

Rosec Jewels crafts this diamond flower promise ring with careful attention to stone placement, setting security, and refined finishing. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch to support lasting product confidence. A Certificate of Authenticity is offered with the jewelry, and care guidance is provided to help preserve the ring’s shine, setting integrity, and everyday wearability over time.

Style and Wearability

The floral top gives the ring a charming focal point, while the slender band keeps the look delicate on the hand. It can be worn as a promise ring, a nature-inspired engagement ring, or a sentimental everyday piece. The design pairs easily with simple diamond studs, a fine chain necklace, or a minimal bracelet, and the available metal options allow the ring to be chosen in a tone that best suits the wearer’s personal style.

Product Information
SKU SHP-RINGS042014740
Width 10 mm
Height 2 mm
Weight 2.30 gm (Approximate)
Center Stone Weight 0.06 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 14 Pieces
Total Weight 0.06 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-14 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Illusion-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-rings

FAQs About: Brilliant Cut Diamond Flower Promise Ring

What makes this diamond flower ring suitable as a promise ring?

Its flower-inspired design carries a natural meaning of growth, affection, and a bond that continues to blossom. The 14 round diamonds add a soft sparkle, making it a meaningful choice for a promise, proposal, anniversary, or commitment milestone.

What diamond cut is used in this ring?

This ring uses round diamonds with a brilliant cut. The design includes 14 diamond pieces with an approximate total diamond weight of 0.06 carat.

What setting style does the Brilliant Cut Diamond Flower Promise Ring have?

The diamonds are arranged in an illusion setting, which helps create a fuller clustered sparkle within the floral design while keeping the ring refined and delicate.

Does this ring include accent stones or a single center diamond?

The ring is designed with 14 round diamonds arranged together in the flower motif rather than a single solitaire focus. The clustered diamond layout supports the floral shape and adds balanced sparkle across the top of the ring.

What metal options are available for this diamond flower promise ring?

The ring is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Does this ring come with a Certificate of Authenticity?

Yes. Rosec Jewels offers a Certificate of Authenticity with the jewelry, along with quality checks that include stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for this diamond promise ring?

Keep the ring away from harsh chemicals, remove it before heavy work or swimming, and store it separately to reduce scratches. Clean it gently with a soft cloth and follow the provided care guidance to help maintain its shine and setting security.