Bezel Set Round Moissanite Starfish Stud Earrings

Regular price $1,751.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Distinctive Design Inspired by the Sea

These starfish stud earrings offer a unique interpretation of classic jewelry by combining a nature-inspired motif with a refined structure. Designed for those who prefer subtle individuality, the starfish shape adds visual interest while maintaining a balanced and wearable form.

Their compact size makes them suitable for daily wear without overwhelming your overall look.

Bezel Setting for a Secure Finish

The bezel setting surrounds the round moissanite stone, offering a clean and structured appearance. This design helps protect the edges of the stone while ensuring it remains securely positioned.

The smooth finish also contributes to comfort, making the earrings easy to wear throughout the day.

Moissanite with Balanced Brilliance

Moissanite is valued for its ability to reflect light with clarity and consistency. Its visual properties create a bright yet controlled appearance that complements both casual and formal styling.

It is created without traditional mining, though its environmental impact varies by production and energy source.

Designed for Everyday Versatility

The combination of a structured setting and a distinctive starfish form makes these earrings adaptable across different occasions. They pair easily with other jewelry while standing out as a subtle statement piece.

This balance makes them suitable for both routine wear and special moments.

Product Information
SKU SHP-EARRINGS082210147
Weight 1.92 gm (Approximate)
MOISSANITE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.06 Carat (Approximate)
Dimension(approx) Round-1.60X1.60 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-earrings

FAQs About: Bezel Set Round Moissanite Starfish Stud Earrings

What is a bezel setting in earrings?
A bezel setting surrounds the stone with a metal rim, providing a secure hold and a smooth, clean appearance.
Are these earrings suitable for daily wear?
Yes, the secure setting and compact design make them suitable for regular use with proper care.
What makes moissanite a popular choice?
Moissanite is appreciated for its clarity and light reflection, offering a bright and refined appearance.
Does the starfish design affect comfort?
The design is crafted to remain smooth and wearable, ensuring comfort while adding a distinctive visual element.
Can these earrings be worn on special occasions?
Yes, their unique design allows them to complement both everyday outfits and more formal occasions.
How should I care for these earrings?
Clean gently with a soft cloth, avoid exposure to harsh chemicals, and store them separately to maintain their finish.