Bezel Set Moissanite and Enameled Evil Eye Ring

Regular price $1,786.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Embrace style with symbolism in this captivating Evil Eye Ring, a piece that effortlessly blends modern minimalism with protective charm. Thoughtfully designed as a Open Cuff Ring, it features two striking focal points that bring both meaning and sparkle to your everyday jewelry collection. On one end sits the enameled blue evil eye motif, known for warding off negative energy and offering a sense of protection and peace. Opposite it is a brilliant round moissanite, bezel set for a clean, modern look. The D-VS1 quality moissanite fiery sparkle adds a touch of luxury, contrasting beautifully with the evil eye. Sleek and slim, the band gracefully wraps around the finger in an open cuff design, making it easy to wear and adjust for a comfortable fit. This Moissanite Wrap Ring is a meaningful piece perfect for daily wear or gifting someone who values both elegance and intention. Whether you are seeking stylish protection or a symbol of good energy and light, this Moissanite Ring for Women makes a powerful, fashion-forward statement. From casual days to special moments, it is a unique reminder to carry strength, sparkle, and positivity wherever you go.

Product Information
SKU SHP-RINGS122041895
Width 2.8 mm
Height 12 mm
Metal Weight 2.00 gm (Approximate)
Total Stone Weight 0.12 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bezel Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
mothers-day-gifts