Bezel Set Blue Sapphire Sunburst Drop Hoop Earrings

Regular price $2,679.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Enhance your fashion with these Sunburst Earrings, crafted to add a touch of sparkle to any ensemble. The Hinged Hoop Earrings showcase a 4 MM round cut blue sapphire, elegantly set in a bezel setting. This stunning stone is positioned at the heart of a sunburst motif, giving the Blue Sapphire Hoop Earrings a luminous and captivating look. The hoop drop design allows for natural movement, drawing attention with every twist. Their dimensions and form make them perfect for both everyday wear and special events, providing a subtle yet bold style statement. Each Blue Sapphire is meticulously chosen for its AAA quality, guaranteeing a stunning, certified gemstone in every earring. The secure setting ensures the stones remain in place while offering a sleek finish. With smooth edges and careful craftsmanship, these Blue Sapphire Earrings are comfortable for extended wear, whether for daytime or evening occasions. These Sunburst Drop Earrings come in a signature jewelry box, making them an ideal gift for birthdays, anniversaries, or special moments. Their adaptable design complements a wide range of outfits and styles, making them a must-have addition to any jewelry collection.

Product Information
SKU SHP-EARRINGS0621107124
Length 28 mm
Width 10.3 mm
Metal Weight 3.78 gm (Approximate)
Total Stone Weight 0.80 Carat (Approximate)
BLUE SAPPHIRE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-4X4 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
blue-sapphire-earrings