Baguette Cut Diamond Eternity Wedding Band Ring

Regular price $4,058.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Baguette Diamond Eternity Wedding Band

This wedding band features baguette cut diamonds arranged in an eternity style, creating a continuous line of gemstones around the ring. The elongated shape of the diamonds forms a structured pattern that highlights the brilliance of each stone.

The design focuses on clean lines and balanced symmetry, making the ring a refined addition to wedding jewelry.

Eternity Band Design

Eternity bands are characterized by gemstones set in a continuous sequence along the ring. This arrangement symbolizes continuity while also creating a uniform band of light reflection around the finger.

The style is widely used in wedding and anniversary rings because of its distinctive gemstone arrangement.

Baguette Cut Diamond Structure

Baguette cut diamonds are recognized for their elongated rectangular shape and step-cut facets. This cut emphasizes clarity and geometric precision rather than intense sparkle.

The linear arrangement of baguette diamonds contributes to the ring’s sleek and modern visual appearance.

Refined Wedding Band Style

Diamond eternity bands combine decorative detail with a balanced ring structure. Their repeating gemstone pattern creates a consistent design that complements a variety of engagement ring styles.

The result is a wedding band that highlights diamonds while maintaining a clean and structured aesthetic.

Product Information
SKU SHP-RINGS111910758
Width 1.4 mm
Height 2.5 mm
Metal Weight 1.60 gm (Approximate)
Total Stone Weight 1.12 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 45 Pieces
Total Weight 1.12 Carat (Approximate)
Dimension(approx) Baguette-1.25X2.20 mm-45 Pcs
Color HI
Cut Brilliant
Shape Baguette
Setting Type Shared-Prong-Setting
Quality Grade SI
View More

FAQs About: Baguette Cut Diamond Eternity Wedding Band Ring

What is an eternity wedding band?
An eternity wedding band features gemstones set continuously around the ring, creating an unbroken line of stones.
What is a baguette cut diamond?
A baguette cut diamond has an elongated rectangular shape with step-cut facets that create a structured and geometric appearance.
Why are baguette diamonds used in eternity rings?
Baguette diamonds are often used because their rectangular shape allows them to sit closely together, forming a smooth and continuous row of stones.
Are eternity bands worn with engagement rings?
Eternity bands are frequently paired with engagement rings because their continuous row of diamonds complements a wide range of ring styles.
What makes baguette diamond rings unique?
Baguette diamond rings are known for their linear arrangement and geometric structure, which creates a sleek and refined appearance.
What occasions are eternity bands suitable for?
Eternity bands are commonly worn as wedding bands, anniversary rings, or milestone jewelry because of their continuous gemstone design.