Amethyst and Diamond Leaf Promise Ring with Beaded Detailing

Sale price $1,282.00 Regular price $1,441.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbolic Design with Natural Influence

This amethyst and diamond promise ring reflects a design inspired by natural elements, combining a leaf motif with a structured form. It is suited for those who appreciate meaningful jewelry that carries both visual character and subtle symbolism.

The balanced composition makes it appropriate for everyday wear while maintaining a refined presence.

Leaf Motif with Beaded Detailing

The leaf-inspired design introduces a soft, organic shape, complemented by beaded detailing that adds texture and definition. This combination enhances the ring’s visual depth without overwhelming the central stone.

The setting is designed to hold the stones securely while maintaining a cohesive and polished structure.

Amethyst with Complementary Diamond Accents

The amethyst provides a distinct color focus, while diamond accents add subtle contrast and brightness. Together, they create a balanced appearance that works well across different styles.

These stones are arranged to highlight the central design without unnecessary complexity.

Designed for Meaningful Everyday Wear

This ring is suitable for promise occasions, personal milestones, or as a symbolic piece of jewelry. Its thoughtful design allows it to be worn comfortably across daily activities while retaining its distinct identity.

It pairs easily with other pieces or can be worn alone as a standalone statement.

Product Information
SKU SHP-RINGS0821209718
Width 2.9 mm
Height 3.7 mm
Weight 1.52 gm (Approximate)
AMETHYST INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Voilet
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.02 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
february-birthstone-jewelry

FAQs About: Amethyst and Diamond Leaf Promise Ring with Beaded Detailing

What does a leaf design symbolize in a ring?
A leaf motif often represents growth, renewal, and connection, making it a meaningful design choice for symbolic jewelry.
Is this ring suitable for everyday wear?
Yes, its balanced structure and secure setting make it suitable for regular wear with proper care.
What role do the diamond accents play in the design?
The diamond accents add subtle brightness and contrast, enhancing the overall look without overpowering the central amethyst.
Does the beaded detailing affect comfort?
The detailing is designed to add texture while maintaining a smooth and wearable finish for everyday comfort.
Can this ring be used as a promise ring?
Yes, its symbolic design and balanced style make it suitable for promise occasions and meaningful milestones.
How should this ring be maintained?
Clean gently with a soft cloth, avoid harsh chemicals, and store separately to help preserve its finish and detailing.