4 Carat Lab Grown Diamond 3 Stone Engagement Ring With IGI Certificate

Sale price $3,486.00 Regular price $4,007.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Ready to wear something that truly stands out? This stunning Past Present and Future Ring is all about bold sparkle and unforgettable presence. Designed to turn heads, this 3 Stone Engagement Ring showcases three impressive round cut lab grown diamonds. The center stone measures a striking 10 MM, giving the ring a grand and luxurious feel. On each side, 4 MM round diamonds add extra brilliance and create a perfectly balanced look. The plain band keeps the design sleek and comfortable, making the Lab Grown Diamond Engagement Ring easy to wear. The simplicity of the band also ensures that all the attention stays on the breathtaking trio of E-VS1 quality lab made diamonds. If you love jewelry that feels powerful and eye-catching, this piece delivers exactly that. This ring is more than just an engagement ring - it can also be styled as a huge statement ring or even a glamorous cocktail ring for special occasions. Whether worn to celebrate a proposal, anniversary, or personal milestone, it carries a strong message of love, commitment, and confidence. With its bold design and meaningful three-stone setting, this Round Shape Diamond Ring represents a bond that grows stronger over time. It is made for someone who is not afraid to shine and appreciates jewelry that makes an impact.

Design Inspiration

Inspired by the elegance of shared moments, this ring features three round lab-grown diamonds arranged in a harmonious sequence that reflects balance and continuity. The central stone is framed by two complementary stones, creating a layered composition that adds depth and visual rhythm. Designed with a refined yet expressive aesthetic, the structure allows light to flow across each diamond seamlessly, resulting in a beautifully composed three-stone diamond ring that captures both sentiment and sophisticated craftsmanship.

Product Information
SKU SHP-RINGS012610103
Weight 3.40 gm (Approximate)
Center Stone Weight 4.00 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 3 Pieces
Total Weight 4.50 Carat (Approximate)
Dimension(approx) Round-10X10 mm-1 Pcs
Round-4X4 mm-2 Pcs
Color E
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS1
View More

Product Parent Collection Handle
igi-certified-diamonds