3/4 CT Created Black Diamond Heart Half Eternity Ring with Diamond

0
Regular price $1,881.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Design with Distinct Contrast

This created black diamond heart half eternity ring is crafted for those who appreciate symbolic design paired with a bold visual identity. The heart-shaped arrangement introduces a softer, expressive element, while the dark tones of the stones add depth and individuality.

It offers a balanced blend of sentiment and contemporary styling.

Heart Motif with Structured Placement

The heart design brings a sense of personal meaning to the ring, while its structured placement along the band ensures a clean and refined appearance. This combination allows the ring to feel expressive without appearing overly ornate.

It is well-suited for those seeking a thoughtful yet modern aesthetic.

Black Diamond for Bold Character

The created black diamonds provide a distinctive contrast, offering a deeper and more understated look compared to traditional white stones. Their tone enhances the overall design, making the ring stand out while maintaining elegance.

Created gemstones are formed without traditional mining, though impact varies by production and energy source.

Diamond Accents for Subtle Balance

Complementing the darker stones, diamond accents introduce a measured level of brightness. This contrast creates visual balance, allowing both elements to stand out without overpowering the design.

The result is a harmonious combination of light and depth.

Half Eternity Design for Practical Wear

The half eternity structure concentrates the design on the visible portion of the band, offering a more practical approach for everyday wear. This layout helps maintain comfort while preserving the ring’s visual impact.

It is an ideal choice for those who want both design focus and ease of use.

Comfort and Daily Use

Designed with wearability in mind, the ring sits comfortably on the finger, making it suitable for regular use. Its balanced construction ensures it feels secure while maintaining a refined profile.

This makes it adaptable to both daily styling and special occasions.

Versatile Styling and Pairing

Whether worn alone or paired with other rings, this piece integrates easily into different jewelry combinations. Its contrast and structure allow it to complement both minimalist and layered looks.

A considered option for those seeking a ring that blends symbolism with modern design.

Product Information
SKU SHP-RINGS052210349
Weight 1.44 gm (Approximate)
SYNTHETIC BLACK DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 1.85 Carat (Approximate)
Dimension(approx) Heart-4X4 mm-5 Pcs
Color Black
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAAA (Synthetic)
DIAMOND INFORMATION
No.of Stones 12 Pieces
Total Weight 0.30 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-12 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI

View More

Product Parent Collection Handle
valentines-day-gifts

Faq About: Created Black Diamond Heart Half Eternity Ring with Diamond

What is a half eternity ring?
A half eternity ring features stones set along the top portion of the band, focusing the design where it is most visible while improving comfort.
What makes black diamonds different from traditional diamonds?
Black diamonds have a darker appearance that offers a bold and understated look compared to the brilliance of traditional white diamonds.
Is this ring suitable for daily wear?
Yes, its half eternity design and balanced construction make it suitable for regular wear with proper care.
Can this ring be stacked with other rings?
This ring can be worn alone or paired with other bands to create a layered look based on personal preference.
What occasions is this ring suitable for?
It is suitable for everyday wear as well as occasions such as anniversaries, celebrations, or meaningful gifting moments.
Does the heart design affect comfort?
The design is structured to maintain comfort while incorporating the heart motif, ensuring it remains wearable for extended use.