2 Carat Pear Lab Grown Diamond Three Stone Engagement Ring IGI Certified

Sale price $2,346.00 Regular price $2,696.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

The shine and beauty of this IGI Certified Lab Grown Diamond Engagement Ring naturally draws attention with its bold yet elegant look. In this Statement Engagement Ring, there sits a gorgeous E-VS1 Quality 2 Carat Pear Shaped Lab Grown Diamond set in claw setting, sculpted in such a way that it brings about the illusion of long fingers and slim hands. The Pear Shape Lab Grown Diamond stones on either side are in an east-west arrangement, contributing a contemporary note and forming a three-stone motif which suggests understated luxury. This Lab Grown Diamond Pear Engagement Ring is manufactured with extreme precision and care and is a fine example of ethical beauty. Ideal as an engagement ring, this 2 Carat Diamond Ring (Lab Grown) communicates through its sparkle instead of words, making every glance special. The 3 Stone Engagement Ring comes in a signature jewelry box and is available in various ring sizes for a comfortable and personalized fit. Whether selected for a proposal or a special occasion, this Teardrop Engagement Ring embodies an elegance that is truly unforgettable. Every detail is crafted to celebrate love, transforming a single ring into a lasting story of brilliance that remains forever with two hearts united. You will get all of the brilliance of a perfect and colorless diamond without having to spend a fortune.

Product Information
SKU SHP-RINGS072610191
Metal Weight 2.08 gm (Approximate)
Center Stone Weight 2.00 Carat (Approximate)
LAB GROWN DIAMOND(IGI) INFORMATION
No.of Stones 1 Pieces
Total Weight 2.00 Carat (Approximate)
Dimension(approx) Pear-11X7 mm-1 Pcs
Color E
Cut Brilliant
Shape Pear
Setting Type Claw-Set
Quality Grade VS1
LAB GROWN DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Pear-2.50X4.00 mm-2 Pcs
Color E-F
Cut Brilliant
Shape Pear
Setting Type Claw-Set
Quality Grade VS
View More