1 Carat Solitaire Citrine Infinity Stud Earrings

Regular price $1,321.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate a significant promise with this stylish pair of Infinity Stud Earrings, thoughtfully crafted to represent eternal love and connection. Each earring showcases a stunning 5 MM round citrine gemstone, securely set in prong setting and elegantly embraced by a beautifully designed infinity motif. The infinity symbol signifies continuity, commitment, and an unbreakable bond, making these Citrine Stud Earrings a profoundly meaningful choice for a promise day or any event that honors dedication. Made with AAA quality genuine citrine, these gemstones exhibit a lovely blue color and remarkable clarity, embodying sophistication and timeless charm. Citrine, recognized as the birthstone for november, adds extra significance, symbolizing tranquility, harmony, and enduring love. The Citrine Infinity Earrings are equipped with screw back closures to ensure a secure and comfortable fit, providing confidence throughout the day. With expert craftsmanship, these November Birthstone Earrings are built to last, preserving their beauty over time. Their elegant design makes them perfect for both casual wear and special occasions, offering versatility while maintaining grace.

Product Information
SKU SHP-EARRINGS042163905
Length 11.1 mm
Width 5.8 mm
Metal Weight 1.50 gm (Approximate)
Total Stone Weight 1.02 Carat (Approximate)
CITRINE INFORMATION
No.of Stones 2 Pieces
Total Weight 1.02 Carat (Approximate)
Dimension(approx) Round-5X5 mm-2 Pcs
Color Yellow
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
citrine-earrings