1.6 Carat Lab Grown Orange Sapphire Bezel Set Engagement Ring

Sale price $1,980.00 Regular price $2,276.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Flower Engagement Ring captures the essence of natures beauty, perfect for someone who appreciates meaningful details. At its heart is a 7 MM round cut lab created orange sapphire, securely set in bezel setting. Surrounding the center stone are delicate flower petals, creating a lovely pattern reminiscent of blooming gardens. Made with AAAA quality lab created orange sapphire and hallmarked metal, this Round Engagement Ring promises lasting beauty and responsible sourcing. Its simple design gives it the charm of a timeless piece, meant to hold significance and memories. The floral motif adds a romantic and feminine flair, making the Lab Grown Orange Sapphire Ring ideal for engagements or special milestones. Thoughtfully designed and meticulously crafted, this Sapphire Flower Ring is ready to be cherished. It arrives in a signature jewelry box with a certificate of authenticity, making it a thoughtful gift or a meaningful addition to your own collection.

Product Information
SKU SHP-RINGS012610021
Metal Weight 3.50 gm (Approximate)
Center Stone Weight 1.60 Carat (Approximate)
LAB CREATED ORANGE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 1.60 Carat (Approximate)
Dimension(approx) Round-7X7 mm-1 Pcs
Color Orange
Cut Brilliant
Shape Round
Setting Type Bezel Setting
Quality Grade AAAA
View More