1.3 Carat Certified Lab Grown Diamond Teardrop Stud Earrings

Sale price $1,599.00 Regular price $1,838.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Grace your ears with timeless elegance by wearing these Statement Stud Earrings featuring a 1.3 Carat pear shaped lab grown diamond gemstone of EF-VS Quality set in prong setting with small round gemstones set on a unique wavy metal motif. These Lab Grown Diamond Earrings come with screw back closure for secure wear. Brought to you by Rosec Jewels, these Designer Earrings are handcrafted with ethically sourced, eco-friendly gemstones and come with a certificate of authenticity, its a thoughtful and budget friendly choice for your daily wear or any meaningful occasion. Perfect for birthdays or anniversaries, surprise your beloved with the gift of everlasting brilliance of Diamond Studs, as some moments deserve to dazzle. These earrings have a unique and sparkling design that catches the eye, making them a great choice for anyone starting their jewelry collection. Add a touch of shine to your wedding look with these classic and elegant Diamond Teardrop Earrings, which are essential for any jewelry collection and a stylish accessory for any occasion.

Product Information
SKU SHP-EARRINGS022510003
Metal Weight 1.78 gm (Approximate)
Total Stone Weight 1.44 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 12 Pieces
Total Weight 1.44 Carat (Approximate)
Dimension(approx) Pear-5X7 mm-2 Pcs
Round-1.20X1.20 mm-10 Pcs
Color E-F
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade VS
View More