1.2 Carat Round Pink Tourmaline Flower Engagement Ring

Regular price $3,282.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral-Inspired Symbol of Commitment

This 1 carat round pink tourmaline flower engagement ring is designed for those who appreciate romantic details and expressive color. The round center stone brings balanced brilliance, while the floral-inspired setting creates a soft, nature-influenced silhouette.

Its vibrant pink hue offers a distinctive alternative to traditional engagement rings, making it ideal for a proposal that feels personal and memorable.

Flower Setting and Round Cut Balance

The round cut enhances light reflection across the surface of the pink tourmaline, delivering consistent sparkle. Surrounding floral elements frame the center in a petal-like arrangement, adding texture and dimension.

This design approach combines symmetry from the round cut with the organic character of a flower motif, creating a harmonious composition.

Pink Tourmaline Characteristics

Pink tourmaline is admired for its vivid tones that range from soft blush to deeper rose shades. Its lively color provides a romantic aesthetic that stands apart from more conventional center stones.

With mindful wear and appropriate care, pink tourmaline can be enjoyed as a meaningful gemstone choice for engagement jewelry.

High-Level Features

This engagement ring features a round pink tourmaline center set within a flower-inspired design. The overall style emphasizes color vibrancy, decorative structure, and a balanced round silhouette suited for a romantic proposal.

Product Information
SKU SHP-RINGS012610024
Metal Weight 3.50 gm (Approximate)
Center Stone Weight 1.20 Carat (Approximate)
PINK TOURMALINE INFORMATION
No.of Stones 1 Pieces
Total Weight 1.20 Carat (Approximate)
Dimension(approx) Round-7X7 mm-1 Pcs
Color Pink
Cut Brilliant
Shape Round
Setting Type Bezel Setting
Quality Grade AAA
View More

FAQs About: Round Pink Tourmaline Flower Engagement Ring

What makes a flower engagement ring design unique?
A flower engagement ring features petal-like elements or floral motifs that frame the center stone, adding decorative detail and a romantic aesthetic.
Is pink tourmaline suitable for everyday engagement wear?
Pink tourmaline can be worn regularly with proper care. Avoiding impact and harsh chemicals helps maintain its appearance over time.
Does a round cut enhance the sparkle of pink tourmaline?
The round cut is designed to maximize light return, helping to enhance the overall brilliance and lively appearance of the gemstone.
Can this ring be paired with a simple wedding band?
Compatibility with a straight band depends on the ring’s profile and floral structure. Some designs may pair best with contoured bands.
Is a pink gemstone engagement ring considered traditional?
While traditional engagement rings often feature clear stones, pink gemstones offer a distinctive and personal alternative that reflects individual style.