0.9 Carat Certified Lab Grown Diamond Round Cut Engagement Ring

Sale price $1,931.00 Regular price $2,219.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Expression of Faith

The Certified Lab Grown Diamond Catholic Cross Heart Necklace is designed for those who wish to wear their faith with quiet confidence. The cross symbolizes devotion and spiritual strength, while the heart reflects compassion and enduring love. Together, they create a pendant that feels personal, symbolic, and refined.

Thoughtful Design with Balanced Proportions

The cross and heart elements are carefully structured to maintain visual harmony. Lab grown diamonds are set to highlight the form without overwhelming the design, allowing light to enhance each contour. Exact details regarding stone size, total carat weight, metal options, and measurements are provided in the product detail tables above.

Lab Grown Diamond Characteristics

Lab grown diamonds possess the same physical and optical properties as mined diamonds. They are created without traditional mining, though environmental impact varies by production and energy source. Certification and grading information can be reviewed in the specification section for complete transparency.

High-Level Features

  • Catholic cross and heart motif combined in one elegant pendant.
  • Set with certified lab grown diamonds for refined brilliance.
  • Designed for everyday wear or meaningful gifting occasions.
  • Available in precious metal options as listed in the product specifications.
Product Information
SKU SHP-RINGS052410142
Width 5.5 mm
Height 4.5 mm
Metal Weight 2.80 gm (Approximate)
Center Stone Weight 0.99 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.99 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQ's About: Certified Lab Grown Diamond 6 MM Round Cut Engagement Ring

Does this necklace include a chain?
Please refer to the product detail tables above to confirm whether the chain is included and to review available chain length options.
Are the lab grown diamonds certified?
Certification and grading details are provided in the product specification section above for accurate and verified information.
Is a lab grown diamond considered real?
Yes. Lab grown diamonds have the same physical, chemical, and optical properties as mined diamonds and are classified as real diamonds.
Can this necklace be worn daily?
Lab grown diamonds are durable and suitable for everyday wear when properly cared for. Routine cleaning helps maintain their brilliance over time.
What metal options are available?
Available metal types and finishes are listed in the product detail tables above. Please review that section for complete and accurate information.