0.8 Carat Solitaire Moonstone Celtic Knot Ring with Diamond

Regular price $3,302.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Moonstone Solitaire Engagement Ring

This engagement ring features a moonstone center stone presented in a solitaire design, complemented by subtle diamond accents. The luminous character of the moonstone creates a soft glow that gives the ring a distinctive and refined appearance.

Celtic Knot Band Design

The band incorporates a Celtic knot motif, a design traditionally associated with continuity and interconnectedness. The intricate pattern adds decorative detail while creating a symbolic element within the ring’s structure.

Moonstone Center Stone

Moonstone is recognized for its unique optical effect known as adularescence, where light appears to move across the surface of the gemstone. This natural glow gives the stone a subtle and captivating visual presence.

Diamond Accent Details

Diamond accents complement the moonstone by adding gentle brilliance to the design. These stones provide contrast while drawing attention to the central gemstone without overpowering it.

Symbolic Engagement Ring Style

The combination of a moonstone solitaire and Celtic knot detailing creates a ring that blends symbolism with elegant design. The overall composition offers a distinctive alternative to traditional engagement rings.

Product Information
SKU SHP-RINGS082220545
Metal Weight 5.00 gm (Approximate)
Center Stone Weight 0.85 Carat (Approximate)
MOONSTONE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.85 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color light blue
Cut Brilliant
Shape Round
Setting Type Peg-Head-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.06 Carat (Approximate)
Dimension(approx) Round-1.60X1.60 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Peg-Head-Setting
Quality Grade SI
View More

Product Parent Collection Handle
moonstone-rings
What is moonstone?
Moonstone is a gemstone known for its luminous effect called adularescence, where light appears to move across the surface of the stone. This creates a soft glowing appearance.
What does a Celtic knot design symbolize?
Celtic knot designs traditionally symbolize continuity and interconnectedness. The looping pattern has no beginning or end, representing enduring connection.
Is moonstone suitable for engagement rings?
Moonstone engagement rings are often chosen for their distinctive glow and unique appearance. Proper care helps preserve the gemstone and maintain its surface quality.
What role do diamond accents play in this ring?
Diamond accents add subtle brilliance and contrast to the design. They frame the moonstone and contribute additional sparkle without dominating the centerpiece.
How should a moonstone ring be cleaned?
Clean the ring with mild soap, lukewarm water, and a soft cloth or brush. Avoid harsh chemicals and ultrasonic cleaners to protect the gemstone.