0.6 Carat Lab Created Ruby Vintage Flower Engagement Ring

Sale price $2,652.00 Regular price $3,049.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Make your proposal unforgettable with this stunning Flower Shaped Engagement Ring, designed to capture the beauty of love in full bloom. Featuring a vibrant 5 MM round-cut lab created ruby at its center, this ring instantly draws attention with its rich color and brilliant sparkle. The ruby is beautifully surrounded by a delicate floral design, creating a romantic and feminine look that feels both elegant and unique. Each petal of the flower is adorned with shimmering round cut moissanite stones, adding incredible brilliance from every angle. The sparkling moissanites continue along the distinctive wide band, giving the Lab Created Ruby Engagement Ring a luxurious appearance while enhancing its overall charm. Together, the fiery AAAA quality lab ruby and dazzling D color VS1 clarity moissanites create a beautiful contrast that makes this Vintage Flower Ring truly stand out. Crafted in solid metal, this statement engagement ring is designed for lasting beauty and everyday comfort. The intricate openwork detailing within the flower design adds depth and character, making it a piece that looks just as gorgeous up close as it does from a distance. Inspired by natures elegance, the floral motif symbolizes growth, love, and new beginnings, making it a meaningful choice for an engagement or special occasion. This Ruby Cocktail Ring is perfect for someone who loves vintage-inspired jewelry with a modern twist.

Product Information
SKU SHP-RINGS122042952
Width 7 mm
Height 11.5 mm
Metal Weight 5.10 gm (Approximate)
Center Stone Weight 0.65 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
MOISSANITE INFORMATION
No.of Stones 128 Pieces
Total Weight 0.51 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-104 Pcs
Round-1X1 mm-24 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
vintage-inspired-engagement-rings