0.4 Carat Emerald and Diamond Heart Drop Pendant

Regular price $3,250.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Pendant with Elegant Movement

The 1 Ct Emerald and Diamond Heart Drop Pendant is designed for those who appreciate refined symbolism combined with graceful design. The heart-shaped drop element introduces a sense of movement, allowing the pendant to catch light naturally with every motion.

Its balanced composition makes it suitable for both everyday wear and special occasions.

Heart Drop Design with Refined Detailing

The drop-style setting allows the heart motif to hang delicately, creating a fluid and elegant silhouette. This structure enhances visibility while maintaining a lightweight and comfortable feel when worn.

Diamond accents are incorporated to add subtle brilliance, complementing the design without overwhelming the centerpiece.

Emerald Center with Diamond Accents

Emeralds are valued for their rich green color and distinctive character, making each piece visually unique. They are best suited for mindful wear due to their natural characteristics.

Diamonds enhance the pendant by adding contrast and light reflection, balancing the depth of the emerald with refined sparkle.

High-Level Features Buyers Appreciate

The pendant is designed to sit comfortably while offering gentle movement, allowing it to adapt well to different necklines and styling preferences.

Its versatile design makes it easy to wear alone for a minimal look or layer with other pieces for added depth.

Product Information
SKU SHP-PENDANT052178020
Weight 3.20 gm (Approximate)
Center Stone Weight 0.50 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 23 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-22 Pcs
Round-1X1 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
emerald-necklace

FAQs About: 1 Ct Emerald and Diamond Heart Drop Pendant

Is emerald suitable for everyday wear?
Emeralds are best suited for careful wear as they require gentle handling compared to harder gemstones.
What is a heart drop pendant design?
A heart drop pendant features a hanging design where the centerpiece moves slightly, adding elegance and visual flow.
How do diamonds enhance this pendant?
Diamonds add brightness and contrast, enhancing the overall appearance without overpowering the emerald.
Is this pendant suitable for gifting?
Yes, its heart design makes it a meaningful option for gifting on special occasions.
Can this pendant be layered with other necklaces?
Yes, it can be styled alone or layered with other necklaces depending on personal preference.
Who is this pendant ideal for?
It is ideal for individuals who appreciate symbolic designs with a refined and elegant appearance.